How Inertial Navigation Systems Actually Work: MEMS Sensors, Quaternion Kinematics, and Extended Kalman Filtering

A comprehensive deep dive into Inertial Navigation Systems (INS). Examine MEMS accelerometers, Sagnac effect gyroscopes, strapdown coordinate transformations, unit quaternions, dead reckoning error accumulation, Extended Kalman Filter (EKF) sensor fusion, and ZUPT zero-velocity updates.

systemsroboticsnavigationkalman-filtersensorsquaternionsphysics

How FIX Protocol and High-Frequency Matching Engines Actually Work: Tag-Value Encoding, Limit Order Books, and Zero-Allocation Systems

A comprehensive deep dive into financial exchange infrastructure. Examine Financial Information eXchange (FIX) session messaging, Price-Time Priority matching engine algorithms, lock-free Disruptor ring buffers, Market Data ITCH/OUCH binary feeds, and zero-allocation memory architectures.

systemsfintechtradingmatching-enginefix-protocolperformancelow-latency

How CRDTs Actually Work: Conflict-Free Replicated Data Types, Semi-Lattices, and State Vectors

A comprehensive deep dive into Conflict-Free Replicated Data Types (CRDTs). Examine state-based (CvRDT) vs operation-based (CmRDT) architectures, semi-lattice upper bounds, LWW-Element-Sets, OR-Sets, sequence indexing (YATA/Automerge), vector clocks, tombstone garbage collection, and local-first synchronization.

systemscrdtdistributed-systemsalgorithmsconsensusdatabase

How PCIe Architecture Actually Works: Packet Framing, Credit-Based Flow Control, and DMA Bus Mastering

A comprehensive deep dive into PCI Express architecture. Examine physical layer 128b/130b encoding, PAM4 signalling, Transaction Layer Packets (TLP), credit-based flow control, Split Transaction mechanics, MSI-X interrupt routing, and DMA bus mastering.

systemspciehardwarekerneldmaperformance

How Zero-Knowledge Proofs Actually Work: From Arithmetic Circuits to SNARK Verification

Arithmetic circuits, Rank-1 Constraint Systems, Quadratic Arithmetic Programs, KZG polynomial commitments, and bilinear pairings.

securitycryptographyzero-knowledgezk-snarksalgorithms

How Post-Quantum Cryptography Actually Works: Lattice Mathematics, ML-KEM, and the Mechanics of Kyber

Module Learning With Errors, polynomial rings, Number Theoretic Transform acceleration, error distributions, and Fujisaki-Okamoto decapsulation.

securitycryptographypost-quantumalgorithmsprotocols

How eBPF and XDP Actually Work: Running Sandboxed Bytecode in the Network Driver

In-kernel verifier bounds checking, JIT instruction translation, driver-level packet interception, and BPF maps without sk_buff overhead.

networkinglinuxkernelsecurityperformance

How io_uring Actually Works: Zero-Syscall Asynchronous I/O in the Linux Kernel

Submission and completion rings, shared memory mmap, lock-free pointer barriers, SQPOLL kernel threads, fixed buffers, and zero-copy packet dispatch.

systemslinuxkernelstorageperformance

Why Open-Source AI Models Are Vulnerable to Model Poisoning

Backdoored weight matrices, malicious Safetensors/Pickle exploits, fine-tuning dataset triggers, and model supply chain security.

ai-securitymodel-poisoningsupply-chain-securitysafetensorsllm-safety

How Smart City EV Charging Networks Get Exploited

Open Charge Point Protocol (OCPP), WebSocket security, RFID card cloning, local CAN bus exposure, and power grid disruption risks.

ev-chargingocppsmart-citieshardware-hackinggrid-security

How DNS Tunneling and Exfiltration Actually Work

Recursive DNS lookup exploitation, sub-domain data encoding (base32/hex), authoritative nameserver data capture, and DNS TXT tunnels.

dns-tunnelingdata-exfiltrationnetwork-securitymalware-analysisdns

How Trunked Radio Systems and P25 Monitoring Work

Project 25 (P25) control channel decoding, C4FM/CQPSK digital modulation, talkgroup tracking, and SDR monitoring infrastructure.

rf-signalsp25trunked-radiosdrpublic-safety

Why Automated Vulnerability Scanners Miss Critical Exploits

SAST/DAST scanner limitations, business logic flaws, state machine bypasses, broken access control, and manual threat modeling.

application-securitysastdastvulnerability-scannersecurity-audit

How KV Cache and FlashAttention Accelerate LLM Inference

PagedAttention memory management, FlashAttention GPU kernel IO-awareness, KV cache VRAM footprint, and batch inference throughput.

llm-inferencekv-cacheflashattentiongpu-programmingvllm

How Reverse Engineering Binaries Actually Works

ELF/PE file parsing, Ghidra disassembly, GDB dynamic debugging, control flow graph reconstruction, and binary deobfuscation.

reverse-engineeringbinary-analysisghidragdbassembly

How Municipal Water and Power Telemetry Networks Get Exposed

Remote Terminal Units (RTUs), cellular gateways, exposed MQTT brokers, unencrypted telemetry links, and OT security exposures.

scadacritical-infrastructureot-securitymqttutility-networks

Why Vibe-Coded Database Schemas Cause Data Corruption

Missing foreign key constraints, unindexed join columns, transaction isolation bugs, and lock contention in AI-scaffolding ORM code.

databasespostgresqlschema-designvibe-codingdata-integrity

How RAG (Retrieval-Augmented Generation) Actually Works

Document chunking, dense vector embeddings, HNSW ANN indexing, hybrid sparse-dense retrieval, and context re-ranking pipelines.

ragvector-searchembeddingsllmsinformation-retrieval

How IMSI Catchers and Rogue Cell Towers Intercept Phones

Stingray cell-site simulators, 5G/4G down to 2G/GSM cellular downgrade attacks, IMSI extraction, and unencrypted mobile telemetry interception.

cellular-securityimsi-catcherstingraygsm-encryptionmobile-surveillance

How Surveillance Cameras Can Be Spoofed and Blinded

Infrared LED blooming, CMOS sensor oversaturation, RTSP stream hijacking, adversarial patch perturbation, and NVR frame-replay attacks.

surveillancecomputer-visioncamera-securityadversarial-attacksrtsp

Why Auditing AI-Generated Code Is Harder Than Human Code

Superficial readability vs deep logic flaws, phantom API dependencies, subtle boundary condition bugs, and review fatigue in AI-assisted code bases.

code-auditai-generated-codesecurity-reviewsoftware-qualitycode-review

How Fine-Tuning and Alignment Modify LLM Weights

Supervised Fine-Tuning (SFT), LoRA parameter-efficient low-rank matrix updates, Direct Preference Optimization (DPO), and catastrophic forgetting.

llm-finetuningloradpomachine-learningmodel-alignment

How ADS-B Aircraft Tracking and RF Spoofing Work

1090MHz Pulse Position Modulation, unencrypted aviation transponder telemetry, flight tracking networks, and SDR ghost aircraft RF injection.

rf-signalsads-baviation-securitysdrtelemetry-spoofing

How Rogue and Malicious Servers Intercept Internet Traffic

BGP route hijacking, rogue DHCP servers, ARP cache poisoning, malicious DNS resolvers, and TLS interception proxies.

network-securitybgp-hijackingmitm-attacksdns-spoofingtraffic-interception

Why Public AI Models Suffer from Context Poisoning Attacks

Indirect prompt injection, untrusted document indexing, RAG payload poisoning, and context boundary isolation failures in multi-tenant AI systems.

prompt-injectionai-securityrag-securitycontext-poisoningllm-vulnerabilities

How Stack and Heap Memory Corruption Exploits Work

Stack frame buffer overflows, heap metadata corruption (use-after-free, double-free), Return-Oriented Programming (ROP), and ASLR/DEP bypasses.

memory-corruptionbinary-exploitationrop-chainsreverse-engineeringc-programming

How Keyless Car Entry Relay Attacks Actually Work

Passive Keyless Entry (PKES) low-frequency wake-up signals, UHF response transmission, dual-radio range extension, and distance-bounding defenses.

automotive-securityrf-hackingrelay-attackpkeshardware-security

How Smart Traffic Control Grids Get Hacked

NTCIP protocols, inductive loop sensor manipulation, 900MHz wireless preemption spoofing, and conflict monitor safety hardware.

smart-citiestraffic-gridshardware-hackingntcipinfrastructure-security

How Command and Control Infrastructure Actually Works

Malware C2 beaconing, domain fronting, DNS TXT record tunneling, malleable HTTP profiles, and sleep obfuscation techniques.

c2-infrastructuremalware-analysisred-teamingnetwork-securitythreat-hunting

Why Rigorous Technical Audits Are Mandatory for Every System

Manual code auditing methodology, architectural threat modeling, logic flaw identification, and invariant verification beyond automated linters.

code-auditsecurity-auditthreat-modelingsoftware-qualityengineering-discipline

How to Optimize LLM Tokens, Credits, and Inference Latency

Prompt compression, semantic response caching, speculative decoding, grammar-constrained token sampling, and token budgeting for LLM inference.

llm-optimizationinference-latencytoken-compressioncost-engineeringai-infrastructure

How LLM Context Windows and Attention Limits Actually Work

Quadratic attention math, RoPE positional encodings, KV cache allocation, attention attenuation, and the needle-in-a-haystack retrieval boundary.

llmsattention-mechanismcontext-windowtransformersmachine-learning

How SCADA and Smart City Infrastructure Actually Work

Programmable Logic Controllers (PLCs), Human-Machine Interfaces (HMIs), unauthenticated Modbus TCP/DNP3 protocols, and operational technology (OT) security risks.

scadasmart-citiesindustrial-controlot-securityinfrastructure

Why Autonomous AI Agents Are Dangerous in Production

Unrestrained tool execution loops, indirect prompt injection vulnerabilities, privilege escalation, file system pollution, and agency hazards in LLM agent runtimes.

ai-securityautonomous-agentsprompt-injectionllm-safetyapplication-security

How ALPR and Flock Camera Surveillance Networks Actually Track You

Optical character recognition, infrared LED arrays, LTE mesh backhaul, vehicle feature extraction, and municipal camera correlation databases.

surveillancealprcomputer-visionprivacynetworking

Why Vibe Coding Creates Brittle and Vulnerable Systems

Architectural debt, missing edge-case validation, phantom dependencies, subtle concurrency race conditions, and silent security regressions in AI-assisted code.

software-engineeringvibe-codingsecurity-debtcode-qualityarchitecture

How LLM Training Actually Works: From Tokenization to Loss Convergence

BPE tokenization pipelines, cross-entropy loss computation, 3D parallelism across GPU clusters, mixed-precision FP16/BF16 stability, and SFT/DPO alignment loops.

machine-learningllm-trainingtransformersdistributed-systemsgpu

How Sub-GHz RF Signals and Rolling Codes Get Hacked

ASK/FSK modulation at 315MHz and 433MHz, KeeLoq framing structures, SDR signal decoding, rolljam timing attacks, and hardware key fob vulnerabilities.

rf-signalswireless-securitysub-ghzsdrhardware-hacking

How the Dewey Decimal System Actually Works

DDC structure, call number synthesis, shelf ordering, Linux automation, and why Dewey still works well in public libraries but not every collection.

library-sciencesystemsmetadatalinux

How Supply Chain Signing Actually Works

Supply chain signing is not a badge on a package. It is a chain of digest, identity, transparency, provenance, and policy around specific bytes.

securitysoftware-supply-chainsigningprovenance

How DDoS Mitigation Actually Works

A deep dive into DDoS mitigation: attack shapes, anycast, scrubbing, SYN cookies, origin shielding, and the tradeoffs behind keeping systems reachable.

securitynetworkingddosavailability

How Web Application Firewalls Actually Work

A real WAF is an HTTP parser and policy engine that normalises, scores, and gates requests before the origin sees them, with hard tradeoffs in visibility, latency, and false positives.

securityhttpwafreverse-proxies

How API Gateways Actually Work

Routing, auth, quotas, protocol translation, retries, and why an API gateway is really a policy data plane with a control plane attached.

systemsapi-gatewaysplatform-engineeringdistributed-systems

How gRPC Actually Works

Proto contracts, HTTP/2 channels, trailers, flow control, deadlines, and balancer behaviour that make gRPC fast only when the transport is understood.

networkinggrpchttp2protobufrpc

How Leader Election Actually Works

Heartbeats, quorum votes, leases, and fencing tokens that let one distributed system node act without letting two do it at once.

systemsdistributed-systemsconsensusleader-election

How PostgreSQL MVCC Actually Works

Tuple headers, snapshots, visibility checks, HOT updates, and vacuum horizons in PostgreSQL's version of multi-version concurrency control.

databasespostgressystemsconcurrencystorage

How Database Connection Pooling Actually Works

Connection setup, queueing, session pinning, pool sizing, and pooler modes that decide whether scarce database backends stay useful or melt down.

databasessystemspostgresperformanceinfrastructure

How Blue-Green Deployments Actually Work

Blue-green deployment is a traffic cutover discipline, not a magic rollback button. The hard parts are drains, schema compatibility, and state.

systemsdeploymentsdistributed-systems

How Feature Flags Actually Work

Control planes, SDK caches, deterministic hashing, kill switches, and why feature flags are really small distributed policy engines.

systemsfeature-flagsdistributed-systemsrelease-engineering

How Object Storage Actually Works

Buckets, manifests, multipart uploads, erasure coding, metadata quorums, and the reason object stores feel simple only because they hide a distributed storage system behind HTTP.

systemsstoragedistributed-systemss3

How LSM Trees Actually Work

A deep look at memtables, SSTables, Bloom filters, tombstones, compaction strategies, and the tradeoffs that make LSM trees brilliant for write-heavy systems and awkward for others.

storagedatabaseslsm-treessystems

How Distributed Tracing Actually Works

A deep technical guide to distributed tracing, from traceparent headers and span lineage to sampling, collectors, async hops, and failure modes.

systemsobservabilitydistributed-tracingopentelemetry

How Queue-Backed Job Systems Actually Work

The mechanics behind durable job handoff, leases, retries, idempotency, dead-letter queues, and worker fleets that survive crashes without losing work.

systemsqueuesbackground-jobsdistributed-systems

How systemd Actually Works

A mechanism-first tour of systemd: units, transactions, activation, cgroups, readiness, journald, and the failure modes that matter on real Linux hosts.

linuxsystemdservicessystems

How Linux Capabilities Actually Work

A mechanism-first tour of Linux capabilities: per-thread credential sets, execve maths, file xattrs, user namespaces, and the real limits of root splitting.

linuxkernelsecuritysystems

How cgroups Actually Work

The real mechanics behind Linux cgroups: hierarchy rules, controller files, quotas, reclaim, local OOM, and why containers and systemd both depend on them.

linuxcgroupscontainerssystems

How Service Meshes Actually Work

A deep technical guide to service meshes, from pod-level traffic interception and xDS config propagation to workload identity, mTLS, routing policy, retries, telemetry, and production failure modes.

systemsservice-mesheskubernetesenvoy

How Secrets Management Actually Works

Secrets management is the machinery that stores, unwraps, distributes, rotates, leases, and revokes high-value credentials without spraying them across machines.

securityinfrastructurekmsoperations

How SPF, DKIM, and DMARC Actually Work

SPF checks the sending path, DKIM signs the message, and DMARC aligns visible authorship so receivers can decide whether mail is trustworthy.

securityemaildnssmtp

How Email Delivery Actually Works

Submission, MX lookups, SMTP queues, spam checks, retries, and the store-and-forward machinery that decides whether mail arrives or stalls.

systemsemailsmtpdns

How Reverse Proxies Actually Work

From TLS termination and request routing to forwarded headers, connection pooling, retries, buffering, and caching, a technical deep-dive into how reverse proxies actually work.

networkinghttpreverse-proxiesinfrastructure

How Retries and Idempotency Actually Work

Timeouts, duplicate requests, idempotency keys, retry budgets, and the state machines that stop one logical operation from happening twice.

systemsdistributed-systemsapisreliability

How Circuit Breakers Actually Work

Circuit breakers are local admission control for failing dependencies. This deep dive covers state machines, trip logic, half-open probes, and the failure modes that matter in production.

systemsresiliencedistributed-systemsavailability

How PostgreSQL Vacuum Actually Works

The tuple cleanup, index maintenance, visibility maps, freezing, and autovacuum rules that keep MVCC from turning into bloat and wraparound.

databasespostgressystemsstorageperformance

How etcd Actually Works

Raft log replication, MVCC revisions, watches, leases, compaction, and the operational limits that make etcd ideal for control planes.

systemsdistributed-systemsetcdkubernetes

How Raft Actually Works

Leaders, election timeouts, quorums, commit rules, snapshots, and how Raft keeps one replicated history under failure.

systemsdistributed-systemsconsensusraft

How Kubernetes Scheduling Actually Works

A deep technical look at how kube-scheduler really places Pods: queueing, filtering, scoring, preemption, volume topology, and why requests matter more than live CPU graphs.

kubernetescontainersorchestrationsystems

How Redis Actually Works

Event loops, RESP, hash tables, expiry cycles, persistence, and the memory tradeoffs that make Redis fast until forks or hot keys bite.

systemsdatabasesredismemory

How DNSSEC Actually Works

DNSSEC adds signatures to DNS data, but the real mechanism is RRsets, DS digests, validator states, negative proofs, and careful key rollovers.

networkingsecuritydnsdnssec

How Webhooks Actually Work

Event creation, signed delivery, retries, idempotency, and the queueing discipline that makes webhook systems survive the real internet.

systemsapiswebhookssecurity

How Database Replication Actually Works

Snapshots, WAL shipping, row streams, replica lag, failover, and the consistency tradeoffs behind every read replica.

systemsdatabasesreplicationstorage

How API Rate Limiting Actually Works

A deep dive into API rate limiting: identity keys, fixed and sliding windows, token buckets, shared counters, 429 semantics, and distributed failure modes.

systemsapidistributed-systemsperformance

How Certificate Pinning Actually Works

A mechanism-first deep dive into certificate pinning: SPKI hashes, trust narrowing, backup pins, HPKP failure, and when pinning still makes operational sense.

securitytlspkimobile

How Symmetric Cryptography Actually Works

Symmetric cryptography is shared-secret engineering: keys, nonces, modes, integrity tags, and lifecycle rules that decide whether encrypted systems stay private or fail loudly.

securitycryptographyencryptionaes

How Session Management Actually Works

Session management is the machinery that turns one successful login into a controlled sequence of trusted requests, revocations, renewals, and expiry decisions.

securityauthsessionsweb

How Public-Key Cryptography Actually Works

Public-key cryptography solved key distribution, then grew into signatures, key exchange, certificates, and now post-quantum hybrids. Here is the mechanism behind it.

securitycryptographypublic-keypki

How OAuth 2 Actually Works

OAuth 2 is a delegation protocol, not a login button. Here is how grants, codes, PKCE, scopes, refresh tokens, and resource servers really fit together.

securityoauthauthidentity

How JWTs Actually Work

JWTs are signed claim containers, not session magic. Their safety depends on strict verification, storage, rotation, and revocation rules.

securityauthjwtcryptography

How HMAC Request Signing Actually Works

HMAC request signing lives or dies on canonical bytes, replay controls, and key discipline. Here is the mechanism that makes it work.

securityapicryptographyauth

How CSRF Protection Actually Works

CSRF protection is about stripping ambient authority from cross-site requests before the browser can spend a user session on the wrong action.

securitybrowserauthweb

How XSS Defense Actually Works

XSS defence is not one header or one library. It is a set of rules that keep hostile bytes from becoming executable browser state.

securitybrowserxssweb

How CORS Actually Works

CORS is not a firewall. It is the browser rule for when JavaScript may read a cross-origin response. Here is how preflights, credentials, caching, and misconfigurations actually behave.

securitywebbrowserhttp

How SQL Injection Actually Works

SQL injection happens when user input crosses the code-data boundary inside a query. Here is how exploits, blind probes, and prepared statements actually work.

securitydatabaseswebsql

How TCP Congestion Control Actually Works

A deep technical walkthrough of TCP congestion control, from congestion collapse and the ACK clock to slow start, CUBIC, BBR, ECN, queueing, and why throughput and latency fight each other.

networkingtcpcongestionperformanceprotocols

How WebSocket Protocol Actually Works

A deep technical walkthrough of WebSocket, from the HTTP upgrade and masking rules to framing, liveness, proxy behaviour, backpressure, and why real-time systems still need careful application design.

networkingwebsocketprotocolsrealtimeweb

How NAT Traversal Actually Works

From STUN and UDP hole punching to ICE priorities, TURN relays, and symmetric NAT failure modes, a technical deep-dive into NAT traversal.

networkingnatwebrtc

How Load Balancing Actually Works

From ECMP and Maglev to health checks, draining, retries, and global steering, a technical deep-dive into how load balancing actually works.

networkingload-balancingdistributed-systems

How IPv6 Addressing Actually Works

A deep technical walkthrough of IPv6 scopes, /64 subnets, SLAAC, neighbour discovery, privacy addresses, and the operational rules that make IPv6 addressing work on real networks.

networkingipv6addressing

How HTTP Caching Actually Works

A deep technical walkthrough of cache keys, freshness, validators, revalidation, and the failure modes that make HTTP caching fast when configured well and dangerous when configured badly.

networkinghttpcaching

How 3-D Secure Actually Works

A technical deep dive into directory servers, issuer ACS systems, frictionless authentication, challenge flows, device fingerprinting, exemptions, soft declines, and liability shift.

systemsbankingpaymentssecurity

How ATM Networks Actually Work

A technical deep dive into ATM switch routing, card verification, authorisation, dispensing control, cassette accounting, electronic journals, reversals, and settlement.

systemsbankingatmpayments

How Bank Reconciliation Actually Works

A technical deep dive into nostro accounts, sub-ledgers, statement matching, breaks, suspense, ageing, retry queues, and the operational reality of proving bank records agree.

systemsbankingledgerspayments

How Banking Systems Scale Actually Works

A technical deep dive into hot account contention, sharded ledgers, write ordering, idempotency, event sourcing, posting engines, cut-off jobs, and reporting pressure.

systemsbankingscalabilityledgers

How Card Payments Actually Work

A technical deep dive into issuers, acquirers, scheme networks, authorisation messages, clearing files, interchange, stand-in processing, offline approvals, and merchant settlement.

systemsbankingpaymentscards

How Contactless Payments Actually Work

A technical deep dive into NFC field coupling, EMV contactless kernels, mobile wallet tokenisation, CDCVM, transaction limits, relay risk, and offline counters.

systemsbankingpaymentssecurity

How EMV Actually Works

A technical deep dive into EMV application selection, AIP and AFL, SDA, DDA, CDA, terminal action codes, issuer scripts, cryptograms, and chip-card fraud economics.

systemsbankingpaymentssecurity

How ISO 8583 Actually Works

A technical deep dive into MTIs, primary and secondary bitmaps, variable-length data elements, private fields, reversals, settlement files, and why card systems still use ISO 8583.

systemsbankingpaymentsprotocols

How Payment Gateways Actually Work

A technical deep dive into hosted fields, tokenisation, PCI scope reduction, fraud engines, idempotency, retries, 3-D Secure routing, acquirer failover, and webhooks.

systemsbankingpaymentssecurity

How Payment Switches Actually Work

A technical deep dive into ISO 8583 routing, message transformation, issuer reachability, stand-in logic, duplicate suppression, timeout handling, and active-active switch design.

systemsbankingpaymentsswitching

How POS Terminals Actually Work

A technical deep dive into POS terminals, EMV kernels, APDU exchange, terminal risk management, secure PIN entry, receipts, fallback, and store-and-forward processing.

systemsbankingpaymentshardware

How Real-Time Payments Actually Work

A technical deep dive into instant payment rails, acknowledgements, fraud decisions measured in seconds, liquidity prefunding, finality, retries, and high-availability payment switching.

systemsbankingpaymentsreliability

How Bank Transactions Actually Work

A technical deep dive into authorisation, posting, settlement, holds, reversals, chargebacks, and why available balance differs from ledger balance in real banking systems.

systemsbankingpaymentscards

How Copy-on-Write Actually Works

The lazy duplication trick behind fork(), Linux page faults, Docker layer copy-up, filesystem snapshots, and database MVCC, plus the places where the phrase means similar economics but different machinery.

systemslinuxkernelmemoryfilesystemsdatabasescontainers

How Core Banking Actually Works

A deep dive into core banking systems, ledger architecture, derived balances, product engines, end-of-day processing, and why postings matter more than mutable balance fields.

systemsbankingledgerspayments

How CPU Cache Coherence Actually Works

MESI states, invalidation traffic, false sharing, store buffers, memory barriers, and the hardware protocol that keeps multi-core code barely manageable.

systemscpuhardwareconcurrency

How Double-Entry Ledgers Actually Work

A deep dive into debit and credit logic, chart of accounts, suspense handling, reconciliation, and why scalable banking systems treat ledger postings as the real source of truth.

systemsbankingledgersaccounting

How PKI Actually Works

A deep dive into public key infrastructure: CA hierarchies, certificate chains, X.509 extensions, revocation, CT logs, and what pinning really pins.

securitytlspkicryptography

How the Linux Boot Process Actually Works

From UEFI and GRUB through kernel entry, initramfs, switch_root, systemd, cgroups, and the exact logs and failure modes behind a modern Linux boot.

linuxbootkernelsystems

How the Linux Kernel Handles Memory Allocation

A deep tour of buddy allocation, slab and SLUB caches, `kmalloc`, `vmalloc`, reclaim, compaction, and the OOM killer when Linux runs out of easy memory.

linuxkernelmemorysystems

How Malware Persists on Windows

Registry run keys, scheduled tasks, services, DLL and COM hijacking, bootkits, and the Windows startup surfaces malware abuses when one-shot code execution is not enough.

securitywindowsmalwareoperating-systems

How Side-Channel Attacks Actually Work

Timing leaks, cache probes, power analysis, Spectre, Meltdown, and the constant-time engineering required when secret data can influence the machine in ways the ISA never exposes.

securitycpucryptographymicroarchitecture

How System Calls Actually Work

A deep tour of the userspace-kernel boundary: libc wrappers, registers, the syscall instruction, seccomp, ptrace, table dispatch, and return paths on Linux.

linuxkernelsyscallssystems

How VPNs Actually Work

TUN and TAP interfaces, WireGuard handshakes, IPSec tunnel and transport mode, MTU headaches, split tunneling, and the exact boundary between what a VPN hides and what it does not.

networkingsecurityvpnwireguard

How Ballistic Missile Early Warning Actually Works: DSP, SBIRS, Phased Arrays, and the Detection-to-Decision Timeline

A technical deep dive into missile early warning, from boost plume detection by DSP and SBIRS satellites to phased-array radar track building, sensor handoff, and the physics that compress the decision window for midcourse defence.

defencemissilessatellitesradar

How CDNs Actually Work

From anycast routing and edge cache hierarchies to purge propagation, shielding, and origin protection, a technical deep-dive into how CDNs actually work.

networkingcdnweb

How HTTP/2 Actually Works

From binary framing and HPACK to stream prioritisation, flow control, and TCP head-of-line blocking, a technical deep-dive into what HTTP/2 actually changed.

networkinghttp2protocols

How Multicast Actually Works

From IGMP membership reports and PIM distribution trees to TTL scoping, RPF checks, and why multicast stayed niche on the public internet, a technical deep-dive into how multicast actually works.

networkingmulticastrouting

How Submarine Communications Actually Work: ELF, VLF, Buoys, Acoustics, and the Bandwidth Problem at Depth

A technical deep dive into how submarines communicate through seawater using ELF and VLF reception, floating wire antennas, buoyant masts, NATO VERDIN style shore transmitters, satellite bursts, and low-rate acoustic links.

defencesubmarinescommunicationsrf

How TLS 1.3 Actually Works

From ClientHello and X25519 to HKDF key schedule, forward secrecy, session tickets, and 0-RTT tradeoffs, a technical deep-dive into how TLS 1.3 actually works.

networkingtlsprotocols

How Counter-Drone Systems Actually Work: RF Jamming, Kinetic Defeat, Directed Energy, and Geofencing

A technical deep dive into how counter-drone systems detect, classify, disrupt, and defeat small unmanned aircraft using RF jamming, GNSS denial, protocol takeover, kinetic effectors, directed energy, and geofencing enforcement.

defencedroneselectronic-warfarerf

How Forensic Data Recovery Actually Works

Forensic recovery starts with the difference between deleting a reference and destroying bytes. Filesystems, journals, SSD controllers, SQLite freelists, write blockers, and encryption all determine whether lost data can be reconstructed or whether it is gone for good.

securityforensicsstoragefilesystems

How Cell Tower Triangulation Actually Works

Phone location from the mobile network is not one technique but several. RSSI, timing advance, uplink TDOA, and LTE OTDOA all estimate position differently, with very different accuracy, and none of them is the same thing as a StingRay pretending to be a base station.

securitysurveillancemobilerf

How Mass Internet Surveillance Works

Mass internet surveillance is built from choke points, protocol metadata, and selective content inspection. Fibre taps, IXPs, backbone routers, DNS resolvers, lawful intercept platforms, and retention systems together create visibility at national scale even when content encryption has made blanket reading far harder.

securitysurveillanceinternetprivacy

How Compilers Actually Work

Lexing, parsing, semantic analysis, intermediate representation, optimisation, register allocation, and code generation in the systems that turn source text into machine code.

systemscompilersprogramming-languagesllvm

How Database Indexes Actually Work

B tree structure, page layout, clustered and secondary indexes, index scans, covering queries, and the storage costs hidden behind every fast lookup.

databasessystemsstorageindexes

How Large Language Models Actually Work

Transformer layers, tokenisation, attention math, KV cache, quantisation, and the engineering constraints that turn a trained model into a working inference service.

machine-learningllmssystemstransformers

How Tor Actually Works

Onion routing, directory authorities, circuit construction, relay roles, hidden services, and the real attack surfaces that decide whether anonymity holds or fails.

securityprivacytornetworking

How DHCP Actually Works

From the DORA exchange and lease timers to relay agents, PXE boot, and rogue servers, a technical deep-dive into how DHCP actually assigns addresses.

networkingdhcpprotocols

How Ethernet Switching Actually Works

From MAC learning and flooding to VLANs, STP, and unknown unicast, a technical deep-dive into how Ethernet switches actually move frames inside a LAN.

networkingethernetprotocols

How NAT Actually Works

From conntrack tables and port rewriting to hairpin NAT, CGNAT, and STUN, a technical deep-dive into what network address translation actually does.

networkingnatprotocols

How Time Synchronization Actually Works

A technical deep-dive into NTP strata, clock drift compensation, PPS, IEEE 1588 PTP, GPS-backed reference clocks, and how internet systems actually agree on time.

networkingtimentpptp

How Elevators Actually Work

From traction ropes and counterweights to VVVF drives, progressive safety gears, and destination dispatch algorithms, a complete technical account of how modern lifts work.

systemsengineeringhardware

How Traffic Lights Actually Work

From inductive loop detectors and Webster timing to adaptive SCOOT networks and V2X-connected signals, a complete technical account of how modern traffic lights operate.

systemsengineeringnetworking

How Anti-Satellite Weapons Actually Work: Kinetic Kill, Co-Orbital Attack, and the Debris Problem

A technical deep-dive into anti-satellite weapons, covering direct-ascent kinetic interceptors, co-orbital inspection and attack vehicles, directed energy concepts, cyber attacks on ground stations, the Kessler syndrome, and why every ASAT test creates a debris problem that lasts centuries.

spacedefencesatellitesweapons

How Battlefield Networks Actually Work: Tactical Data Links, Mesh Radios, and the Common Operating Picture

A technical deep-dive into military communications, covering Link 16, Link 22, software-defined radios, mobile ad-hoc networks, blue force tracking, and how L3Harris, Elbit, and Thales connect every soldier, vehicle, and aircraft into a real-time digital battlespace.

networkingdefencecommunicationssystems

How Drone Swarm Coordination Actually Works: Mesh Networks, Consensus, and Autonomous Targeting

A technical deep-dive into drone swarm systems, covering mesh networking, distributed consensus algorithms, task allocation, autonomous target identification, loitering munitions like the IAI Harop, and the counter-UAS systems designed to defeat them.

dronesdefenceautonomynetworking

How Electronic Warfare Actually Works: Jamming, Deception, and the Electromagnetic Battlespace

A technical deep-dive into electronic warfare, from radar warning receivers and digital RF memory jammers to chaff, flares, and how modern EW suites built by L3Harris, Elisra, and Thales detect, classify, and counter radar and communication threats in real time.

electronic-warfaredefenceradarrf

How Military Cyber Weapons Actually Work: From Zero-Day Exploits to Industrial Sabotage

A technical deep-dive into offensive cyber weapons, using Stuxnet as the primary case study to explain zero-day exploit chains, PLC targeting, air-gap traversal, and how state-sponsored cyber operations differ from conventional hacking in sophistication, resources, and operational security.

securitydefencecybermalware

How Military GPS Denial and Spoofing Work: From Jamming Physics to Navigation Warfare

A technical deep-dive into GPS vulnerabilities and countermeasures, covering how jammers overpower satellite signals, how spoofers forge navigation messages, how M-code and controlled reception pattern antennas protect military receivers, and why inertial navigation remains the ultimate fallback.

navigationdefencegpselectronic-warfare

How Military Satellites Actually Work: From Launch to Orbital Intelligence

A technical deep-dive into military satellite systems, from orbital mechanics and radiation-hardened electronics to infrared missile warning constellations and the real engineering behind space-based intelligence.

satellitesdefencespacesurveillance

How Missile Defence Systems Actually Work: From Threat Detection to Kinetic Intercept

A technical deep-dive into missile defence, covering the physics of ballistic and cruise missile intercept, how Iron Dome classifies threats in under two seconds, how Arrow 3 kills warheads in space, and the radar and guidance engineering behind Patriot, S-400, SAMP/T, and David Sling.

defencemissilesradarsystems

How Over-the-Horizon Radar Actually Works: Skywave Propagation and Thousand-Kilometre Detection

A technical deep-dive into over-the-horizon radar, covering ionospheric skywave propagation, surface wave systems, the physics of HF refraction, Doppler processing at extreme ranges, and real OTH-R systems including JORN, NOSTRADAMUS, Sunflower, and the Duga legacy.

radardefencerfpropagation

How Precision-Guided Munitions Actually Work: From INS Drift to Terminal Guidance

A technical deep-dive into precision-guided munitions, covering inertial navigation, GPS-aided guidance, laser designation, infrared seekers, scene-matching algorithms, and how systems like JDAM, Paveway, SPICE, and Storm Shadow achieve metre-level accuracy.

defenceguidancenavigationweapons

How Radar Countermeasures Actually Work: ECM, ECCM, and the Electromagnetic Arms Race

A technical deep-dive into radar countermeasures, covering noise jamming, deception techniques like range-gate pull-off and velocity-gate steal, expendable decoys, towed decoys, and how modern AESA radars fight back with frequency agility, pulse compression, and monopulse tracking.

radarelectronic-warfaredefencerf

How Satellite Communication Jamming and Anti-Jam Actually Work

A technical deep-dive into SATCOM vulnerabilities and protection, covering uplink and downlink jamming physics, spread spectrum techniques, frequency hopping, nulling antennas, and how systems like AEHF, Milstar, Skynet, and Syracuse survive in contested electromagnetic environments.

communicationsdefencesatelliteselectronic-warfare

How Signals Intelligence Actually Works: Intercepting, Locating, and Analysing RF Emissions

A technical deep-dive into SIGINT, covering how ground stations, aircraft, and satellites intercept radio emissions, how TDOA and FDOA geolocate transmitters, how metadata analysis builds intelligence from traffic patterns, and why modern encryption has shifted the focus from content to context.

sigintdefencesurveillancerf

How Stealth Technology Actually Works: Shaping, Materials, and the Physics of Radar Cross Section

A technical deep-dive into stealth, covering radar cross section physics, shaping principles, radar-absorbent materials, infrared signature management, and how passive radar and low-frequency systems threaten to erode the stealth advantage.

stealthdefenceradaraerospace

How Synthetic Aperture Radar Satellites Actually Work: Imaging the Earth Through Clouds and Darkness

A technical deep-dive into spaceborne SAR, from pulse compression and azimuth focusing to stripmap, spotlight, and ScanSAR modes, covering real systems like TecSAR, COSMO-SkyMed, TerraSAR-X, and the physics that let radar see what optical sensors cannot.

radarsatellitesdefencedsp

How Wide-Area Motion Imagery Actually Works: Persistent Surveillance at City Scale

A technical deep-dive into wide-area motion imagery, covering how systems like ARGUS-IS and Gorgon Stare stitch hundreds of camera feeds into city-scale video, track every moving object simultaneously, and store petabytes of footage for retroactive analysis.

surveillancedefencecomputer-visionimaging

How ARP Actually Works: The Invisible Protocol That Maps IP to Hardware

A deep technical walkthrough of ARP, from request-reply mechanics and cache management to gratuitous ARP, proxy ARP, ARP spoofing, and why this protocol from 1982 still holds the modern LAN together.

networkingarpprotocolslayer-2

How Your Computer Finds Your Router When You Type 192.168.1.1

Tracing every step from typing an IP address in your browser to reaching the router admin panel, through routing tables, subnet masks, ARP resolution, Ethernet framing, and the private address space that makes it all work.

networkingroutingarplayer-2

Why Network Printers and IoT Devices Always Seem to Know Their IP Address

How DHCP leases, mDNS, SSDP, gratuitous ARP, and link-local addressing work together so that your printer, Chromecast, and smart bulbs always show up on the network without manual configuration.

networkingiotdhcpmdns

Why WiFi Does Not Guarantee Your Message Gets Delivered

The internet is a best-effort network by design. WiFi delivers frames when it can, IP routes packets without promises, and every messaging app from WhatsApp to Telegram must build its own reliability on top. This is the end-to-end argument in action.

networkingmessagingprotocolsend-to-end

How Encryption Actually Protects Your Phone

Your phone encrypts every byte on its storage with a key derived from your PIN, a hardware-bound secret in the Secure Enclave or Titan chip, and a key derivation function slow enough to make brute force take years on-device. The gap between on-device and off-device cracking speed is the entire security model.

securitycryptographymobileprivacy

How Facial Recognition Actually Works

A facial recognition system detects a face in a frame, aligns it to a canonical pose, passes the crop through a deep CNN that compresses it into a 128 or 512 dimensional embedding vector, and then measures the cosine distance to every enrolled template in the database. A match is a number below a threshold, not a visual comparison.

securitymachine-learningprivacysurveillance

How License Plate Readers Track Every Car In A City

An ANPR camera reads a license plate in under 50 milliseconds using infrared illumination and OCR, logs the plate number, GPS coordinates, timestamp, and a photo to a central database, and can do this for every vehicle passing at motorway speed. A network of these cameras reconstructs the complete movement history of any car in the country.

securitysurveillanceprivacycomputer-vision

How Police Track A Phone After A Crime

When a phone moves through a city it leaves a continuous trail of cell tower handoffs, GPS fixes, Wi-Fi probe requests, and carrier metadata. Law enforcement reconstructs that trail from CDR logs, silent pings, IMSI catchers, and cloud subpoenas to place a device at a specific location within metres and seconds.

securityforensicsmobileprivacy

How Secure Boot And The TPM Actually Work

A modern laptop refuses to run unsigned boot code and seals your disk encryption key to the exact firmware, option ROMs, and bootloader it saw last boot. This is a walk through UEFI Secure Boot, measured boot, PCR extension, TPM 2.0 key sealing, BitLocker and LUKS integration, and the attacks that the chain was built to stop.

securitysystemstpmsecure-boot

How Stingray Cell Tower Simulators Actually Work

An IMSI catcher is a portable base station that broadcasts a stronger signal than the real tower, forcing every phone in range to connect to it. Once connected, the device captures the phone IMSI, IMEI, and in some configurations can intercept calls and SMS by downgrading the connection to unencrypted GSM.

securitysurveillancemobileprivacy

Why Branch Prediction Often Gets The Last Iteration Wrong

A simple for loop that runs the same number of iterations every call often still pays a misprediction penalty on the final exit. Basic predictors learn that the branch is taken, so the one fall-through iteration catches the pipeline off guard unless a dedicated loop predictor steps in.

systemscpuhardwareperformance

Why Your CPU Has So Many Execution Units It Will Never Fully Use

A modern out-of-order core packs a dozen or more execution units, but most real programs keep barely half of them busy at any given cycle. The surplus is not waste; it is latency insurance, a structural answer to the unpredictability of real instruction streams.

systemscpuhardwareperformance

Why Deleted Messages Are Never Really Deleted

Pressing delete on a message removes a pointer, not the data. The actual bytes persist in NAND flash pages, SQLite WAL journals, cloud backups, and carrier logs until they are physically overwritten, and forensic tools like Cellebrite and GrayKey know exactly where to look.

securityforensicsstorageprivacy

Why x86 Processors Break Instructions Apart And Fuse Them Back Together

Every modern x86 core cracks variable-length CISC instructions into fixed-width micro-ops, schedules them through an out-of-order engine, and then fuses some of them back into single operations before execution. This looks like wasted effort until you trace the engineering constraints that made each step necessary.

systemscpuhardwarex86

Why Your Car Knows Where You Have Been

A modern car records GPS coordinates, Bluetooth pairing history, Wi-Fi hotspot connections, voice commands, OBD-II diagnostics, and dozens of CAN bus event logs to internal storage that persists across factory resets. Forensic investigators, insurers, and manufacturers can all read this data, often without the driver knowing it exists.

securityforensicsprivacyautomotive

Why Your Smartphone Feels Warm In Your Hand

A modern phone SoC dissipates 3 to 10 watts inside a sealed aluminium and glass shell with no fan, no heat sink fins, and no airflow. The warmth you feel is the thermal management system working exactly as designed, spreading waste heat through metal frames and throttling clocks to keep the silicon below its damage threshold.

systemshardwaremobilethermal

How Filesystems Survive A Power Cut

Unplug a laptop mid-write and ext4 comes back cleanly while a poorly designed filesystem would be corrupt. This is a deep look at journals, log-structured filesystems, copy-on-write, fsync semantics, write barriers, and the PostgreSQL fsync scandal that changed how engineers think about durability.

systemsfilesystemsstoragedatabases

How USB Actually Works, From Enumeration To Thunderbolt

USB looks like a cable you plug in and it just works. Underneath there is a strict host-controlled bus, a descriptor dance, transaction pipes, class drivers, power negotiation, and alternate modes that turn the same connector into a display, a disk, and a network card.

systemsusbhardwareprotocols

How Android Flash Storage Actually Works, And Why You Cannot Really Delete A File

A modern Android phone stores every photo, message, and secret on a chip that physically cannot overwrite data in place. This is a deep walk through eMMC and UFS, the flash translation layer, f2fs, file-based encryption, and why a factory reset destroys a key rather than the data itself.

systemsstorageandroidsecurity

How DRAM Actually Works, From A Capacitor To Rowhammer

A single DRAM cell is one transistor and one tiny capacitor that leaks charge and forgets its contents in milliseconds. This is a walk through how billions of those leaky cells are organised into banks, rows, and channels, how the memory controller refreshes them in time, and how an attacker can corrupt one row by hammering its neighbours.

systemsdramhardwaresecurity

How Browser Extensions Actually Work, And How They Get Weaponised

A browser extension is a small web app with a frightening amount of power. This is what lives inside a .crx file, how service workers, content scripts, and isolated worlds fit together, and why a single compromised update can read every page you ever open.

securitybrowserextensionsweb

Why iOS Apps Cannot Run On Android, Even Though Both Phones Are ARM64

An iPhone 15 and a Pixel 8 use nearly identical ARM64 chips. Instructions, registers, memory model, and cache architecture are almost the same silicon. Yet an .ipa cannot run on Android. This is a walk through every layer above the CPU that makes the two operating systems incompatible, and why a Wine-style translation layer has never worked for iOS.

systemsiosandroidarm64abi

Why Windows XP Binaries Still Run On Windows 11

Double-click a 2003 .exe on Windows 11 and it starts. Behind that single click is the PE loader, the WOW64 thunk layer, a stable Win32 ABI, a shim database with thousands of entries, and twenty years of deliberate kernel discipline. This is how all of it fits together.

systemswindowsx86_64abicompatibility

How Password Hashing Actually Works

MD5 is broken, SHA-256 is too fast, bcrypt is ageing, scrypt is memory-hard, Argon2 is the modern default. A tour through salts, peppers, work factors, and why every hash you store is a promise about how much CPU, memory, and parallelism an attacker will have to spend to crack it.

securitycryptographyauthhashing

How To Carefully Fix A Vibe-Coded Project

A practical, security-first guide to rescuing a project built on vibes. How to find hardcoded secrets, lock down databases, repair password hashing, configure CORS and CSP, validate input, and ship fixes without breaking production.

securityrefactoringwebauth

How Write-Ahead Logging Actually Works

The log that comes before the data, the protocol that makes crashes safe, and the machinery that lets PostgreSQL, InnoDB, and SQLite keep their promises through power cuts, kernel panics, and full-disk disasters.

databasessystemsstoragepostgres

What A Linux Container Actually Is

Namespaces, cgroups, capabilities, and pivot_root. The kernel primitives that turn a regular Linux process into something that looks, smells, and behaves like a lightweight virtual machine, with no virtualisation at all.

linuxcontainerskernelsystems

How BIOS, UEFI, and CSM Actually Work

A deep tour of what happens between pressing the power button and seeing GRUB, from reset vectors and PEI phases to GPT partitions, option ROMs, ACPI tables, and why CSM is finally disappearing.

firmwareuefibiossystems

How SSDs Actually Work

NAND flash physics, pages and blocks, the Flash Translation Layer, wear levelling, garbage collection, write amplification, TRIM, and why the drive you think you are writing to is doing something very different underneath.

storagessdnandsystems

How Virtual Memory Actually Works

Page tables, TLBs, page faults, copy-on-write, demand paging, huge pages, and the hardware and kernel choreography that turns a 48-bit virtual address into a physical byte of DRAM.

systemslinuxkernelmemory

How 5G Actually Works: The Radio System Behind the Marketing

A technical deep-dive into 5G, from NR radio numerology and OFDM to beamforming, standalone cores, scheduling, network slicing, and why low latency is a system property, not a logo.

wirelessrfnetworkingmobile

What Actually Happens When You Delete a File

The syscall path from rm to the free list, why deleted data lingers on your disk, how recovery tools reassemble lost files, and why SSDs quietly destroy everything you thought you knew about undelete.

filesystemsstoragelinuxforensics

How HTTPS Actually Works: Every Byte of the TLS Handshake

A packet-level walkthrough of TLS 1.3, from ClientHello to encrypted application data, covering ECDHE key exchange, certificate chains, AEAD ciphers, and why older TLS versions were broken.

securitynetworkingcryptographyprotocols

How WiFi Actually Works: The Radio Protocol Nobody Reads

From OFDM modulation and channel contention to the hidden node problem, airtime fairness, and why your apartment building is a warzone of overlapping channels.

networkingrfprotocolswireless

DNS: The Internet Phone Book That Everyone Trusts and Nobody Should

How DNS actually resolves a domain, why it was never designed for security, the real cost of DNS hijacking, and what DNSSEC, DoH, and DoT actually fix versus what they do not.

networkingsecuritydnsinfrastructure

How Search Engines Rank Pages: From Crawling to Neural Retrieval

A technical deep-dive into search engine internals, from web crawling and inverted indexes to TF-IDF scoring, PageRank, BM25, learning to rank, and how transformer models changed retrieval.

searchalgorithmsirml

How Tinder Actually Works: The Algorithm Behind the Swipe

A technical breakdown of Tinder Elo scores, the shift to a desirability model, how the algorithm penalizes certain behaviors, and why swiping is the laziest form of matching that every app copies anyway.

algorithmssystemssocialengineering

How GPS Actually Works: Triangulation Is a Lie

A technical deep-dive into GPS from atomic clocks and relativistic corrections to pseudorange calculations, satellite geometry, and why you need four satellites instead of three.

signalsrfnavigationphysics

How Video Compression Actually Works: H.264 Frame by Frame

A technical deep-dive into video compression, from I-frames and motion estimation to DCT transforms, quantization, entropy coding, and the rate-distortion tradeoff that makes streaming possible.

videocompressioncodecsalgorithms

How Linux Decides What Runs Next: CFS, EEVDF, and the Scheduler That Powers Everything

A deep look at the Linux kernel process scheduler, from the O(1) scheduler to CFS to the new EEVDF algorithm in kernel 6.6+. How your operating system juggles thousands of processes without you noticing.

linuxkernelsystemsschedulinglow-level

How BGP Actually Works: The Routing Protocol Holding the Internet Together

A deep technical look at BGP, from autonomous systems and path-vector routing to route advertisements, policy decisions, hijacks, route leaks, and why the global internet still runs on trust.

networkinginfrastructureprotocolsrouting

How Software Defined Radio Works: From Analog Front-End to Digital Signal Processing

A technical deep-dive into SDR, from RF front-ends and ADC sampling to IQ demodulation, FFT spectral analysis, digital filtering, and how a 25 euro USB dongle becomes a radio receiver.

rfsignalssdrdsp

LoRa: How Long-Range Low-Power Radio Actually Works

A complete guide to LoRa, from chirp spread spectrum and link budgets to network capacity and simulation before you buy hardware.

lorarfembeddediotsimulationpython

How Radar Actually Works: From Pulse Timing to Synthetic Aperture

A deep technical guide to radar systems, from basic pulse-echo timing and the radar range equation to Doppler processing, phased array scanning, synthetic aperture radar, and why clutter makes everything harder.

rfsignalsradardsp

How TCP Actually Works: The Protocol That Pretends the Network Is Reliable

A deep technical walkthrough of TCP, from the three-way handshake and sequence numbers to flow control, congestion control, retransmissions, and why one dropped packet can wreck throughput.

networkingprotocolssystemstransport

How QUIC Actually Works: The Transport Protocol That Moved TCP Into User Space

A deep technical walkthrough of QUIC, from packet number spaces and TLS 1.3 integration to stream multiplexing, loss recovery, congestion control, connection migration, and why HTTP/3 needed a new transport.

networkingprotocolstransportperformancesecurity

How Bluetooth Low Energy Actually Works: The Radio Protocol Built for Tiny Batteries

A deep technical guide to Bluetooth Low Energy, from advertising channels and connection events to GATT, PHY modes, power tradeoffs, packet timing, and why BLE behaves nothing like Wi-Fi.

wirelessrfembeddedprotocolsiot