Labs

Interactive experiments that go with our deep dives. Pick a lab, step through the concepts, and see how things actually work under the hood.

196 labs

Inertial Navigation & EKF Fusion

Simulate quadratic dead reckoning error drift, tune Extended Kalman Filter sensor fusion, and inspect ZUPT stance updates.

systemsroboticsnavigationkalman-filtersensorsquaternionsphysics

FIX Protocol & Matching Engine

Inspect ASCII FIX tag-value framing, simulate Price-Time priority limit order book executions, and decode ITCH binary streams.

systemsfintechtradingmatching-enginefix-protocolperformancelow-latency

CRDT State Vector & Convergence

Interactively mutate local replica states, simulate network partitions, and trigger join-semilattice merges for PN-Counters, OR-Sets, and YATA sequences.

systemscrdtdistributed-systemsalgorithmsconsensusdatabase

PCIe Transaction Layer & Flow Control

Simulate TLP packet framing overhead, credit-based flow control limits, and split transaction non-blocking memory access timelines.

systemspciehardwarekerneldmaperformance

Zero-Knowledge Circuit & R1CS System

Inspect arithmetic circuit gate flattening, evaluate Rank-1 Constraint System (R1CS) matrices, test QAP polynomial divisibility, and verify bilinear pairings.

securitycryptographyzero-knowledgezk-snarks

ML-KEM Kyber Lattice Cryptography

Simulate Module-LWE noise error bounds, test Number Theoretic Transform (NTT) acceleration speedup, and verify Fujisaki-Okamoto implicit rejection.

securitycryptographypost-quantumalgorithms

Linux eBPF & XDP Packet Processing Pipeline

Step through driver-level XDP packet interception, test in-kernel verifier pointer bounds checking, and inspect line-rate drops before sk_buff allocation.

networkinglinuxkernelsecurityperformance

Linux io_uring Dual-Ring Buffers

Trace lock-free submission and completion circular rings in shared memory, compare batch syscall dispatch with zero-syscall SQPOLL kthread polling.

systemslinuxkernelstorageperformance

Open-Source AI Model Poisoning & Backdoors

Inspect Safetensors model weight matrices for neural trigger perturbations, test secret trigger phrase execution, and verify SHA-256 hashes.

ai-securitymodel-poisoningsupply-chain-securitysafetensors

EV Charging Networks & OCPP Security

Inspect OCPP 1.6/2.0.1 WebSocket JSON-RPC messages, simulate local CAN bus telemetry, and model grid-scale load drop attack vectors.

ev-chargingocppsmart-citieshardware-hacking

DNS Tunneling & Data Exfiltration

Encode binary data into Base32 subdomain labels, simulate recursive DNS lookup forwarding, and score subdomain Shannon entropy.

dns-tunnelingdata-exfiltrationnetwork-securitydns

Trunked Radio Systems & P25 Protocol

Tune an SDR spectrum analyzer to 851MHz P25 control channels, decode TSBK grant frames, and listen to vocoder talkgroup audio.

rf-signalsp25trunked-radiosdr

Automated Vulnerability Scanner Blindspots

Run SAST AST taint analysis on a target repo, contrast scanner output with manual logic flaw discovery, and configure hybrid security pipelines.

application-securitysastdastvulnerability-scanner

KV Cache & FlashAttention Optimization

Compare contiguous VRAM allocation vs vLLM PagedAttention virtual block paging and simulate FlashAttention SRAM block tiling.

llm-inferencekv-cacheflashattentiongpu-programming

Binary Reverse Engineering & Disassembly

Trace machine code bytes to Ghidra P-code decompilation, step through GDB hardware watchpoints (DR0-DR7), and decode opaque predicates.

reverse-engineeringbinary-analysisghidragdb

Municipal Water & Power Telemetry Security

Monitor municipal water treatment SCADA panels, simulate unauthenticated MQTT/Modbus packet injection, and test TLS cellular VPN tunnels.

scadacritical-infrastructureot-securitymqtt

Vibe-Coded Database Schemas & Data Integrity

Simulate concurrent read-modify-write transactions on unconstrained schemas causing race conditions, orphaned records, and deadlocks.

databasespostgresqlschema-designvibe-coding

RAG & HNSW Vector Retrieval

Traverse multi-layer HNSW graphs, compare dense vector cosine similarity vs BM25 keyword search, and score with Reciprocal Rank Fusion.

ragvector-searchembeddingsllms

IMSI Catchers & Cellular Downgrade Security

Increase rogue cell tower RSRP power levels to force handset reselection, execute 2G GSM cipher mode downgrade, and exfiltrate IMSI.

cellular-securityimsi-catcherstingraygsm-encryption

Surveillance Camera Spoofing & Blinding

Simulate high-power IR LED illumination blooming CMOS image sensors and test unauthenticated RTSP stream replay injections.

surveillancecomputer-visioncamera-securityadversarial-attacks

Auditing AI-Generated Code

Review synthetic pull requests, detect unhandled async exceptions, missing mutex locks, and calculate reviewer cognitive fatigue.

code-auditai-generated-codesecurity-reviewsoftware-quality

LLM Fine-Tuning & Weight Alignment

Visualize LoRA matrix decomposition W = W0 + (alpha/r)*B*A, test rank r choices, NF4 QLoRA quantization, and DPO loss optimization.

llm-finetuningloradpomachine-learning

ADS-B Aircraft Tracking & RF Spoofing

Construct DF=17 112-bit Mode S extended squitter frames, decode CPR coordinates, and inject SDR ghost aircraft onto radar displays.

rf-signalsads-baviation-securitysdr

Rogue Servers & Internet Traffic Interception

Simulate BGP UPDATE prefix hijacking, ARP cache poisoning, rogue DNS responses, and TLS MITM proxy certificate inspection.

network-securitybgp-hijackingmitm-attacksdns-spoofing

AI Context Poisoning & Prompt Injection

Test indirect prompt injection in RAG document ingestion pipelines and compare raw prompt concatenation vs XML-delimited prompt defenses.

prompt-injectionai-securityrag-securitycontext-poisoning

Stack & Heap Memory Corruption Exploits

Inspect x86-64 stack frames, simulate glibc ptmalloc Use-After-Free chunk rewrites, and chain ROP gadgets to hijack execution.

memory-corruptionbinary-exploitationrop-chainsreverse-engineering

Keyless Car Entry & Relay Attack Security

Step through LF 125kHz wake-up trigger amplification, UHF 433MHz reply relay, and IEEE 802.15.4z UWB time-of-flight distance bounding.

automotive-securityrf-hackingrelay-attackpkes

Smart Traffic Control Grid Exploits

Simulate NEMA TS2 traffic signal phase overrides via NTCIP/SNMP and observe Malfunction Management Unit (MMU) green-green safety locks.

smart-citiestraffic-gridshardware-hackingntcip

Command & Control Infrastructure Mechanics

Analyze malleable C2 profiles, DNS TXT base32 chunking, sleep obfuscation memory protection, and JA3 TLS fingerprinting.

c2-infrastructuremalware-analysisred-teamingnetwork-security

Technical Audit Methodology & Threat Modeling

Work through STRIDE threat modeling, manual state machine code audits, and dependency signature verification.

code-auditsecurity-auditthreat-modelingengineering-discipline

LLM Token & Credit Optimization

Benchmark prompt compression entropy pruning, semantic response vector caching, and speculative decoding draft verification.

llm-optimizationinference-latencytoken-compressioncost-engineering

LLM Context Windows & Attention Limits

Inspect O(N^2) self-attention matrix scaling, RoPE complex plane rotations, KV cache memory footprint, and needle-in-a-haystack recall.

llmsattention-mechanismcontext-windowtransformers

SCADA & Smart City Industrial Control

Construct unauthenticated Modbus TCP packets, monitor PLC water pump controls, and test hardware data diode isolation.

scadasmart-citiesindustrial-controlot-security

Autonomous AI Agent Safety & Privilege Controls

Simulate ReAct execution loops, test indirect prompt injection vectors, and enforce Cedar policy security gates.

ai-securityautonomous-agentsprompt-injectionllm-safety

ALPR & Flock Camera Mesh Networks

Trace optical character recognition localization, vehicle feature extraction, and LTE mesh telemetry backhaul.

surveillancealprcomputer-visionnetworking

Vibe Coding Vulnerabilities & Audit Discipline

Audit a vibe-coded code base for service-role key leaks, disabled RLS, unvalidated inputs, and async race conditions.

vibe-codingsecurity-auditcode-qualityarchitecture

LLM Training & Loss Convergence

Explore BPE tokenization, cross-entropy loss gradients, 3D parallelism (FSDP vs Tensor Parallelism), and FlashAttention SRAM tiling.

machine-learningllm-trainingtransformersdistributed-systems

Sub-GHz RF & Rolling Code Security

Step through ASK/FSK modulation, KeeLoq framing, SDR IQ sample capture, and Rolljam dual-radio timing attacks.

rf-signalswireless-securitysub-ghzsdr

Dewey Decimal Shelf Order

Follow a book from broad class to final shelf position, then compare the printed call number with the sortable shelf key staff systems actually use.

systemslibrary-sciencemetadata

Supply Chain Signing Trust Path

Follow one release from digest and workload identity to provenance, transparency, and the final admission decision.

securitysupply-chainsigning

DDoS Mitigation Lab

Run a reflection flood, a SYN flood, or an HTTP work flood through anycast, stateless filters, scrubbing, origin shielding, and route-level admission control.

securitynetworkingddos

Web Application Firewall Decision Lab

Switch between clean traffic, exploit probes, and tuning exceptions to see how parsing, scoring, and enforcement shape what reaches the origin.

securitywebwaf

API Gateways

Trace how a gateway admits the public request, verifies identity, selects a route, rewrites trusted context, and protects internal services from unsafe traffic patterns.

systemsapiplatform

gRPC Lab

Trace one channel from setup through unary framing, multiplexing, flow control, deadlines, and drain behaviour.

networkinggrpchttp2

Leader election under failure

Watch heartbeats stop, a new quorum form, a fresh fence token appear, and the stale leader get rejected at the resource boundary.

systemsdistributed-systemscoordination

PostgreSQL MVCC Snapshot Lab

Watch one row version chain pass through reader snapshots, writer commits, and vacuum eligibility under read committed and repeatable read.

databasespostgresconcurrency

Database Connection Pooling Lab

Watch requests borrow, queue, time out, and return a small set of database sessions under real pressure.

systemsdatabasesperformance

Blue-Green Cutover Simulator

Warm green, switch the traffic control point, drain blue, and see how shared-state compatibility decides whether rollback is real.

systemsdeploymentsrelease

Feature Flag Evaluation Lab

Watch one request move from a versioned flag snapshot through prerequisites, sticky rollout, variant assignment, and a local kill switch.

systemsdeploymentsflags

Object Storage Commit Path

Trace one multipart upload from auth and placement to erasure-coded shards, manifest publish, range reads, and background healing.

systemsstoragedistributed-systems

LSM Tree Lab

Follow one key from WAL to memtable to SSTable, then compare how leveled and tiered compaction pay for the same write history.

systemsdatabasesstorage

Distributed Tracing Lab

Follow one checkout request from edge to payments and a queue worker, then see how one lost carrier splits the trace story.

systemsobservabilitytracing

Queue-Backed Job System

Follow one background job from durable handoff to lease, crash, replay-safe retry, dead-letter handling, and backlog monitoring.

systemsqueuesbackend

systemd activation and supervision lab

Pick a trigger, readiness model, and failure case. Then watch PID 1 load units, build a transaction, create a cgroup, and decide whether the service is really up.

linuxbootsystems

Linux Capability Transition Lab

Track thread sets, file xattrs, bounding masks, ambient carry, namespace scope, and the final allow or deny result.

linuxsecuritykernelsystems

Linux cgroup control path

Build a subtree, hand controllers down, then watch CPU, memory, and task limits change what the kernel allows this workload to do.

linuxcgroupscontainerssystems

Service Mesh Traffic Lab

Trace one pod-to-pod call through interception, xDS state, workload identity, route policy, retries, and hop-level telemetry.

systemsnetworkingservice-mesh

Secrets Management Control Plane

Compare a static secret read with a dynamic lease and watch how identity, policy, KMS unwrap, delivery, and revocation reshape the risk.

securityinfrastructurekmsoperations

SPF, DKIM, and DMARC Lab

Follow one message through path authorisation, content signing, domain alignment, and receiver policy decisions.

securityemaildns

Email Delivery Pipeline

Trace one message from client submission through MX lookup, SMTP retry, filtering, and final mailbox delivery.

systemsemaildelivery

Reverse Proxies

Trace how a reverse proxy terminates the public request, selects an upstream, preserves identity, reuses connections, and decides whether retrying is safe.

networkingwebhttp

Retries and Idempotency Lab

See how the same write request behaves when the response is clean, lost after commit, or retried before the first attempt ever commits.

systemsreliabilityapis

Circuit Breaker State Machine

Watch a caller count failures, open locally, fail fast, test recovery with half-open probes, and close only after the dependency behaves again.

systemsresiliencebackend

PostgreSQL Vacuum Lifecycle

Walk from one live tuple to dead-row cleanup, index maintenance, visibility-map updates, and anti-wraparound freezing.

databasespostgresstorage

etcd Commit Path

Follow one etcd write from leader proposal to quorum commit, MVCC revision, watch delivery, and lagging follower recovery.

systemsdistributed-systemsetcd

Raft Consensus Under Failure

Walk one cluster through quorum commit, leader crash, election, log repair, and snapshot catch-up.

systemsconsensusdistributed-systems

Kubernetes Scheduler Decision Lab

Follow one Pending Pod through queueing, filtering, scoring, preemption, and bind while switching between stateless, GPU, stateful, and high-priority workloads.

kubernetescontainersschedulingsystems

Redis Write Path Lab

Follow one SET command from socket readiness through RESP parsing, the keyspace dictionary, TTL indexing, AOF buffering, replication, and BGSAVE copy-on-write pressure.

systemsdatabasesredismemory

DNSSEC Validation Path

Trace the root trust anchor, parent DS, child DNSKEY, RRset signatures, and denial proofs that decide whether a resolver sets AD or rejects the answer.

networkingdnssecurity

Webhook Delivery Pipeline

Trace one event from provider outbox to signed delivery, durable inbox, idempotent worker, and safe retry handling.

systemsapiintegration

Database Replication Pipeline

Walk one commit from primary WAL to standby receive, remote flush, replay, lag, and failover.

systemsdatabasesreplication

API Rate Limiting Lab

Run the same request burst through fixed windows, sliding control, token buckets, and a shared edge counter.

systemsapiscalability

Certificate Pinning Outcome Explorer

Compare plain PKI, brittle certificate pins, SPKI pins, and backup-pin rotations under the same TLS scenarios.

securitytlspki

AEAD Packet Builder

Assemble key, nonce, associated data, ciphertext, and tag, then see why nonce reuse breaks the whole design.

securitycryptographysystems

Session Lifecycle Simulator

Follow a browser session from anonymous state to login, validation, step-up auth, expiry, and revocation.

securitysessionsweb

Public-Key Operation Map

Switch between legacy RSA transport, modern ECDHE, and digital signatures to see which key does which job, where symmetric crypto takes over, and what later key theft really changes.

securitycryptographyprotocols

OAuth 2 Flow Boundary Lab

Switch between public, confidential, and machine OAuth flows to see where the browser ends, where the token endpoint starts, and which credential actually carries the risk.

securityoauth2auth

JWT Verification Pitfalls

Run one token through a strict verifier, then compare what changes when algorithm policy, key lookup, storage, or revocation discipline gets sloppy.

securityjwtauth

HMAC Request Signing

Watch the client canonicalise a request, sign it, and then see tampering, stale timestamps, or nonce reuse break verification.

securityhmacapi

CSRF Decision Path

Pick the request shape and protection layers, then watch where the browser or the server strips away ambient session authority.

securitycsrfweb

XSS Defence Pipeline

Move one hostile value through real browser sinks, then add the layers that keep data from becoming executable state.

securityxssweb

CORS Decision Lab

Switch between request shapes and policy outcomes to see when the browser sends the request, preflights it, or exposes the response.

securitycorsweb

SQL Injection Boundary Lab

Feed the same payload into unsafe string-built SQL and a prepared statement, then watch the parser and outcome diverge.

securitysqlweb

TCP Congestion Control

Follow one sender as ACKs grow `cwnd`, a queue fills, loss triggers recovery, and modern algorithms choose different ways to probe the same bottleneck.

networkingtcpperformance

WebSocket Upgrade and Framing

Walk from HTTPS origin context into the upgrade handshake, masked browser frames, heartbeats, and a clean protocol close.

networkingwebsocketprotocols

NAT Traversal and ICE Explorer

Change the NAT type on each side and watch how STUN, ICE checks, and TURN relay selection change the path that can actually work.

networkingnatprotocols

Load Balancing Decision Explorer

Compare L7 routing policies under hot backends, ejections, draining, and regional failover while the L4 flow stays pinned to one frontend.

networkingload-balancingweb

IPv6 Addressing

See how delegated prefix space, link-local scope, router advertisements, and neighbour discovery shape a real IPv6 host.

networkingipv6protocols

HTTP Caching

Trace how one response moves through cache key lookup, freshness checks, validation, Vary splitting, and immutable asset reuse.

networkinghttpcaching

3-D Secure Decision Tree

Simulate issuer ACS decisions across frictionless authentication, challenge flows, exemptions, soft-decline retry, liability evidence, and checkout state.

systemsbankingsecurity

ATM Network Message Path

Trace a cash withdrawal through the ATM, acquirer switch, scheme network, issuer, dispenser, journal, reversal path, and settlement.

systemsbankingatmpayments

Bank Reconciliation Queue

Match internal ledger entries to external statement lines, classify amount and reference breaks, age unresolved items, and close controlled repairs.

systemsbankingledgers

Sharded Ledger Contention Simulator

Move payment requests across ledger shards, hot accounts, replay guards, posting queues, cut-off jobs, and reporting snapshots.

systemsbankingscalabilityledgers

Card Payment Sequence

Follow one purchase from POS terminal through acquirer, scheme network, issuer authorisation, clearing, settlement, and merchant funding.

systemsbankingcards

Contactless Payment Timeline

Compare physical card and wallet taps across NFC coupling, contactless kernels, CDCVM, tokenisation, issuer authorisation, offline limits, and relay risk.

systemsbankingpayments

EMV Transaction Trace

Inspect an EMV transaction from application selection through AIP, AFL, records, offline authentication, CVM, action analysis, and cryptogram generation.

systemsbankingsecurity

ISO 8583 Bitmap Builder

Build an ISO 8583-style message from MTI, bitmap bits, fixed fields, LLVAR fields, private fields, and response data.

systemsbankingpaymentsprotocols

Gateway Orchestration Simulator

Route an online checkout through hosted fields, tokenisation, fraud policy, 3-D Secure, acquirer authorisation, idempotent retries, and webhooks.

systemsbankingpayments

Payment Switch Routing Graph

Route a payment through validation, BIN routing, transformation, issuer reachability, duplicate checks, timeout handling, stand-in, and response mapping.

systemsbankingpaymentsswitching

POS Terminal EMV Flow

Step through card detection, APDU exchange, terminal risk management, secure PIN entry, online authorisation, receipts, and fallback handling.

systemsbankingpayments

Real-Time Payment Rail

Send an instant payment through fraud checks, funds reservation, switching, rail acknowledgements, liquidity limits, finality, and timeout recovery.

systemsbankingpayments

Bank Transaction Lifecycle

Follow a card purchase from authorization to hold, posting, settlement, and reversal while balance, availability, and bank-to-bank obligations move on different timelines.

systemsbankingpayments

Copy-on-Write Page Tables

Watch fork share physical pages, clear writable PTE bits, raise a write fault, and allocate a private page only when one process actually diverges.

systemslinuxmemory

Core Banking Posting Visualizer

Trace salary posting, card holds, clearing, and end-of-day balances across customer, suspense, and settlement ledgers.

systemsbankingledgers

CPU Cache Coherence

Step through a two-core MESI state machine and watch one cache line move through read sharing, ownership invalidation, and false-sharing ping-pong.

systemscpuconcurrency

Double-Entry Ledger Simulator

Watch a business event become balanced debit and credit legs, derive customer and control-account views, and then get repaired with an explicit reversing group.

systemsbankingledgers

Certificate Chain Visualization

Follow a representative Let's Encrypt-style chain from the leaf certificate through the intermediate to the ISRG root, then layer OCSP, CT, and pinning on top.

securitytlspki

Linux Boot Ownership Timeline

Step through firmware, bootloader, kernel, initramfs, switch_root, and systemd while the active owner of the machine and its boot log line change in sync.

linuxbootsystems

Buddy Allocator Visualizer

Allocate contiguous page blocks, watch higher-order buddies split, then free them and see coalescing rebuild larger orders under Linux-style allocation rules.

linuxkernelmemory

Windows Persistence Mechanism Map

Select a malware persistence technique and inspect the registry or filesystem path, trigger, and artifact defenders should expect to find.

securitywindowsmalware

Timing Oracle Simulation

Probe a leaky compare function, watch latency averages reveal the correct byte, and then remove the signal with constant-time verification.

securitycpucryptography

System Call Boundary

Follow one syscall from userspace registers through the syscall instruction, seccomp filters, dispatch table, kernel handler, and return path.

linuxkernelsyscalls

WireGuard Tunnel Packet Flow

Trace one packet from a virtual TUN interface through WireGuard encryption, UDP encapsulation, decapsulation, and split-tunnel routing policy.

networkingsecuritywireguard

Ballistic Missile Early Warning

Follow launch detection from infrared satellites to phased-array radar handoff and see how every second affects the interceptor decision window.

defencemissilessatellites

CDN Request Routing

Follow one request from DNS and anycast through edge cache hits, shield cache misses, and global purge propagation.

networkingcdnweb

HTTP/2 Multiplexing

Trace framed requests across one TCP connection, see where HPACK saves bytes, and watch packet loss stall every stream at once.

networkinghttp2protocols

Multicast Distribution Tree

Watch receivers join a multicast group, see selective branching replace flooding, and follow RPF and source-specific multicast logic.

networkingmulticastrouting

Submarine Communications

Trade penetration depth against bandwidth as a submarine moves between ELF and VLF reception, buoys, masts, SATCOM bursts, and acoustic links.

defencesubmarinescommunications

TLS 1.3 Handshake

Walk through ClientHello, key exchange, certificate proof, transcript verification, resumption tickets, and the 0-RTT tradeoff.

networkingtlsprotocols

Counter Drone Systems

Compare RF jamming, GNSS denial, geofence enforcement, kinetic defeat, and directed energy against drones with different autonomy levels.

defencedroneselectronic-warfare

Deletion to Recovery Pipeline

Trace a file from live metadata to deleted blocks, journal remnants, and carving, then see how full-disk encryption changes what recovery can still reveal.

securityforensicsstorage

Cell Tower Location Geometry

Move a handset between two to four towers and compare rough cell sector inference with timing based multilateration and the very different behaviour of a StingRay.

securitysurveillancemobile

Internet Surveillance Choke Points

Follow a flow through the ISP, IXP, DNS layer, and retention system. Compare shrinking content visibility with persistent metadata visibility.

securitysurveillanceinternet

Compiler Pipeline

Move one short program from source text through tokens, AST, IR, and machine code to see what each compiler stage really contributes.

systemscompilersprogramming-languages

B-Tree Index Walk

Trace a lookup from root to leaf, trigger a page split, and see how page order keeps point lookups and range scans fast.

systemsdatabasesindexes

LLM Attention Weights

Watch tokens become embeddings, compare attention weights across positions, and see how KV cache changes latency and memory cost.

systemsllmsmachine-learning

Tor Circuit Builder

Build a Tor path one hop at a time, peel onion layers at each relay, and compare ordinary exit traffic with onion service rendezvous flow.

securitytorprivacy

DHCP DORA Handshake

Watch Discover, Offer, Request, and ACK move between client, relay, and server, then see renewal and rebinding timers keep the lease alive.

networkingdhcpprotocols

Ethernet MAC Learning

See a switch learn source MACs, flood unknown unicast within a VLAN, and block a redundant loop with spanning tree.

networkingethernetprotocols

NAT Translation Table

Follow one flow through PAT, DNAT, hairpin NAT, and STUN. Watch conntrack state appear and see how return traffic finds the original private host.

networkingnatprotocols

Clock Offset Consensus

Watch NTP-style offset intervals converge across several sources, reject a bad peer, and then see how PPS and PTP tighten the final clock discipline.

networkingtimentp

Elevator Traction System

Step through counterweight balance, VVVF drive S-curves, governors, safety gears, door interlocks, dispatch, and regenerative braking in a traction elevator.

systemsengineeringhardware

Traffic Signal Control

Walk a signalized intersection from inductive-loop detection and Webster timing through gap-out, green-wave coordination, emergency preemption, and adaptive control.

systemsengineeringnetworking

Anti-Satellite Weapons

Launch direct-ascent and co-orbital ASAT attacks, trigger debris cascades, and defend with proliferated constellations and space domain awareness.

defencesatellitesasat

Battlefield Network Topology

Build a sensor-to-shooter network from Link 16, Blue Force Tracker, MANET mesh, and JADC2. Toggle nodes, adjust EMCON levels, and see how degraded comms affect the kill chain.

defencenetworkingc4isr

Drone Swarm Coordination

Compare centralized and distributed swarm control as local rules, task allocation, mesh comms, and autonomy scale from a few drones to hundreds.

defencedronesautonomy

Electronic Warfare Suite

Operate the EA/EP/ES triad. Detect threats with a radar warning receiver, classify emitters, deploy noise and DRFM jamming, dispense chaff and flares, and explore cognitive EW.

defenceelectronic-warfareradar

Cyber Weapon Kill Chain

Step through a military cyber operation from initial access to ICS targeting, using Stuxnet, NotPetya, and grid attacks to compare payloads and countermeasures.

defencecybersecurity

GPS Denial and Spoofing

Jam and spoof a GPS receiver, then defend with CRPA nulling, M-code, INS integration, celestial navigation, and multi-source fusion.

defencegpselectronic-warfare

Military Satellite Orbits

Place satellites in LEO, sun-sync, GEO, and Molniya orbits. See Kepler's law, ground tracks, radiation belts, constellation design, and space threats.

defencesatellitesorbits

Missile Defence Layers

Intercept a ballistic missile through boost, midcourse, and terminal phases. Adjust interceptor types, engagement geometry, and see layered defence and cost exchange ratios.

defencemissilesballistic

Over-the-Horizon Radar

Bounce HF signals off the ionosphere to detect targets beyond the horizon. Adjust frequency, layer height, and hop count to see skip zones, MUF limits, and multi-hop geometry.

defenceradarhf

Precision Guided Munitions

Compare guidance methods from laser designation and GPS/INS to imaging IR and TERCOM, then see how jamming or terrain changes CEP.

defencemunitionsguidance

Radar Countermeasures

Deploy noise jamming, DRFM deception, chaff, and towed decoys against a tracking radar. Watch burn-through range, range gate pull-off, and velocity gate pull-off in action.

defenceradarelectronic-warfare

SATCOM Jamming and Anti-Jam

Attack and defend a satellite link. Jam the uplink, then counter with frequency hopping, DSSS, adaptive nulling, and spot beams. Compare LEO and GEO resilience.

defencesatelliteselectronic-warfare

Signals Intelligence Collection

Intercept, geolocate, and analyse signals. Use TDOA positioning, direction finding, traffic analysis, and see how spread spectrum and encryption challenge SIGINT collection.

defencesigintelectronic-warfare

Stealth Radar Cross-Section Explorer

Tune edge alignment, RAM coatings, and frequency to see how stealth shaping shifts radar cross-section across bands and aspects.

defenceradarstealth

SAR Imaging Pipeline

Build a synthetic aperture from a moving radar platform. See how pulse compression, azimuth processing, and spotlight vs stripmap modes create high-resolution ground images from orbit.

defenceradarsatellites

Wide Area Motion Imagery

Fly a WAMI sensor over a city. Adjust altitude and resolution, detect vehicles, track persistently, backtrack forensically, and confront the data and privacy challenges.

defenceisrsurveillance

ARP Resolution

Watch an ARP request broadcast across the LAN, see the unicast reply, and step through cache updates, gratuitous ARP, and spoofing attacks.

networkingarpprotocols

Router Discovery Path

Trace every step from typing 192.168.1.1 in your browser to reaching the router admin panel: routing table, subnet mask, ARP, Ethernet framing, and switch forwarding.

networkingroutingarp

IoT Address Discovery

Step through the full discovery lifecycle of a network printer: DHCP lease, gratuitous ARP, mDNS registration, DNS-SD service advertisement, SSDP notification, and link-local fallback.

networkingiotdhcp

Message Delivery: End-to-End

Follow a chat message across Wi-Fi, internet transit, server storage, push delivery, and client decryption to see why reliability lives above the link layer.

networkingmessagingprotocols

Phone Encryption: Key Hierarchy

Trace how your PIN protects your data through hardware-bound keys, key derivation, per-file encryption, and the critical difference between BFU and AFU state.

securitycryptographymobile

Facial Recognition Pipeline

Follow an image through face detection, landmark alignment, embedding generation, cosine-distance matching, thresholding, and human review.

securitymachine-learningprivacy

ANPR: From Photons to Database

Follow an automatic plate read from IR illumination and image capture through OCR, database lookup, and historical search.

securitysurveillancecomputer-vision

Phone Tracking: Sources and Methods

Walk through the records investigators use to reconstruct a phone's movements: CDR logs, tower timing, GPS history, Wi-Fi probes, silent pings, and geofence data.

securityforensicsmobile

Secure Boot and TPM Sealing

Walk the chain of trust from Boot Guard to BitLocker unseal. See how every stage extends a PCR, and how tampering anywhere in the chain invalidates the disk encryption seal.

securitytpmsecure-bootsystems

IMSI Catcher Attack Sequence

Watch a fake base station force a phone off 4G, capture its IMSI and IMEI on unprotected 2G, and intercept voice traffic through a downgrade attack.

securitysurveillancemobile

Branch Predictor: 2-Bit Counter Walk

Step through a loop and watch a 2-bit saturating counter learn the taken pattern, then mispredict on the final exit. See how the dedicated loop predictor fixes the problem.

systemscpuhardware

CPU Execution Port Utilization

Watch different workloads light up execution ports on a wide superscalar core. Scalar code, vectorised loops, memory copies, and burst parallelism show why most ports sit idle most of the time.

systemscpuhardware

Deleted Data: Where It Hides

Trace a deleted message through filesystem pointers, NAND flash pages, SQLite freelists, and forensic extraction levels from logical to physical.

securityforensicsstorage

x86 Decode: Crack, Fuse, Execute

Watch x86 instructions get cracked into micro-ops, fused for efficiency, eliminated at rename, or expanded by the MSROM. See the micro-op cache bypass decode entirely for hot loops.

systemscpux86

Car Data: What Gets Recorded

Walk through every data source in a modern car that records where you have been: infotainment GPS, CAN bus, Bluetooth pairing, eCall, TPMS, dashcam, and telematics.

securityforensicsautomotive

Smartphone Thermal Budget

Watch skin temperature, junction temperature, and clock speed respond to gaming, charging, ambient heat, and thermal throttling limits.

systemshardwaremobile

fsync Under Power Loss

Trace a single write() through the page cache, filesystem journal, drive cache, and media, then cut power to see what survives reboot.

systemsfilesystemsstorage

USB Enumeration Sequence

Follow a USB device from cable attach to mounted storage: CC negotiation, bus reset, descriptor reads, SetAddress, SetConfiguration, and driver bind.

systemsusbhardware

Android Flash, FTL, and the Cryptographic Wipe

Walk through NAND pages on a phone. Write files, delete them, watch garbage collection, try shred, and see Factory Reset destroy the key instead of the data.

systemsstorageandroidsecurity

DRAM Row Cycle and Rowhammer

Walk one DRAM bank through ACTIVATE, READ, PRECHARGE, and REFRESH, then hammer adjacent rows to see when bit flips appear.

systemsdramhardware

Browser Extension Attack Path

Follow a browser extension from install to privileged API access, content-script injection, and data exfiltration to see where the sandbox actually ends.

securitybrowserextensions

iOS vs Android: The Stack Compared

Climb the layers of both operating systems side by side. Same ARM64 chip at the bottom, completely different kernel, binary format, libc, runtime, frameworks, IPC, GPU API, and signing model above it.

systemsiosandroidabi

Windows Compatibility Layer Cake

Trace a 2003 32-bit installer from double-click to syscall through WOW64, the shim engine, and the 64-bit NT kernel. See why XP binaries still run on Windows 11.

systemswindowsabi

Password Hashing Benchmark

Compare MD5, SHA-256, PBKDF2, bcrypt, scrypt, and Argon2id against offline cracking throughput to see why memory hardness matters.

securitycryptographysystems

Vibe-Coded Project Security Audit

Fix the standard failures in a vibe-coded project one control at a time: exposed secrets, open databases, weak password storage, missing CSP, and permissive CORS.

securityrefactoringsystems

WAL and Crash Recovery

Run transactions through a write-ahead log: begin, update, commit, checkpoint, crash, and recover. Watch the volatile buffer pool rebuild from the durable log.

databasesstoragesystems

Linux Container Primitives

Compose your own container from namespaces, cgroups, capabilities, and seccomp. See the isolation score rise as you add each primitive.

containerslinuxsystems

BIOS vs UEFI Boot Sequence

Step from power-on through POST, boot device selection, and kernel handoff, comparing legacy BIOS with the UEFI SEC, PEI, DXE, and BDS phases.

firmwareuefisystems

SSD NAND and the FTL

Write, read, and erase NAND blocks. See the flash translation layer in action: page programming, block erase, wear leveling, and garbage collection.

storagessdsystems

Virtual Memory Page Walk

Translate virtual addresses through a 4-level x86_64 page table. Watch the TLB fill up, take page faults, and see how the kernel resolves them.

kernelmemorysystems

5G New Radio

Explore 5G NR numerology, sub-6 and mmWave spectrum, beamforming, and network slicing in concrete radio terms.

rf5gwireless

File Deletion and Recovery

Delete a file and watch what really happens: directory entries, inodes, extents, and the journal. Then recover it before the blocks get overwritten.

filesystemslinuxsystems

TLS 1.3 Handshake

Step through ClientHello, ECDHE key exchange, certificate validation, and Finished to see exactly when the connection becomes encrypted.

securitytlsprotocols

WiFi Channel Contention

Watch stations sense the medium, back off, retry after collisions, and see how contention and airtime fairness shape throughput.

rfwifi802.11

DNS Resolution

Follow one lookup from your stub resolver to a recursive resolver, then through root, TLD, and authoritative servers until an IP comes back.

networkingdnsprotocols

Search Engine Ranking

Query a mini corpus and watch TF-IDF, BM25, PageRank, and learning-to-rank score the results step by step.

searchalgorithmsinformation-retrieval

Tinder Algorithm Simulator

Swipe through matches and compare the old Elo-style ranking model with the newer multi-signal ranking system in real time.

algorithmssystems

GPS Trilateration

Move satellites and the receiver, solve pseudorange intersections, and see why a fourth satellite is needed to correct clock error.

rfgpssignals

Video Compression Pipeline

Trace I-, P-, and B-frames through motion estimation, transform, quantization, and entropy coding to see where the bitrate disappears.

videocompressioncodecs

Linux CFS Scheduler

Track virtual runtime, priority weights, preemption, and the red-black tree as the kernel shares CPU time between runnable tasks.

kernellinuxsystems

BGP Path Selection

Advertise competing routes across AS hops, compare local preference and AS path decisions, and watch reconvergence after a link fails.

networkingbgprouting

SDR Signal Processing

Sample RF into IQ, rotate constellation points, inspect the FFT, and demodulate a simple FM signal into audio.

rfsdrdsp

LoRa Link Budget

Adjust spreading factor, bandwidth, coding rate, and transmit power to see the trade-off between range, airtime, and payload rate.

lorarfiot

Radar Range Simulator

Transmit pulses, measure echo delay and Doppler shift, then compare classic pulsed radar with FMCW range-velocity processing.

rfradarsignals

TCP Three-Way Handshake

Trace SYN, SYN-ACK, and ACK between client and server, and see how sequence numbers and state transitions establish the session.

networkingtcpprotocols

QUIC Transport Protocol

Compare QUIC with TCP and TLS: faster setup, per-stream loss isolation, connection migration, and user-space deployment.

networkingquicprotocols

BLE Connection Lifecycle

Follow advertising, connection setup, timed connection events, GATT exchanges, and sleep intervals to see where BLE actually saves power.

rfbleiot